PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00012404-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 251aa    MW: 27979.8 Da    PI: 6.9068
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00012404-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-211978357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++tkeq++ Le+l+ +  r+psae++++++++l    +++ ++V++WFqN++a++++
  WALNUT_00012404-RA 19 SRWNPTKEQITMLENLYSQgIRTPSAEQIQQITSRLraygHIEGKNVFYWFQNHKARQRQ 78
                        8*****************99**************************************97 PP

2Wus_type_Homeobox1161.8e-371780265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +++RW+Pt+eQi++Le+ly++G+rtP++e+iq+it++L++yG+ie+kNVfyWFQN+kaR+rqkq
  WALNUT_00012404-RA 17 SSSRWNPTKEQITMLENLYSQGIRTPSAEQIQQITSRLRAYGHIEGKNVFYWFQNHKARQRQKQ 80
                        579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9161479IPR001356Homeobox domain
SuperFamilySSF466892.78E-131686IPR009057Homeodomain-like
SMARTSM003891.4E-41683IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-81978IPR009057Homeodomain-like
PfamPF000461.1E-181978IPR001356Homeobox domain
CDDcd000866.42E-72080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEGDNVDIGG AVETPVSSSR WNPTKEQITM LENLYSQGIR TPSAEQIQQI TSRLRAYGHI  60
EGKNVFYWFQ NHKARQRQKQ KQESSMAFAN GYFHRTQPLF PPCPNVFCRP YYLAHNDLGF  120
YPQYHQPKVF LAAGGMGSRS SRTEKLEKPR SAYDGAGYNS VQLGYDHHHH VPMDTCNNSA  180
GVITNSSQET LSLFPLHPTG ILQGKTGKSS IVSGNSTGTS SFSEIDHQEG SGDQLYFDFF  240
SGEGSCESDY S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016457.12e-85WUSCHEL related homeobox 2, putative
SwissprotQ6X7K11e-52WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A061GX692e-85A0A061GX69_THECC; WUSCHEL related homeobox 2, putative
STRINGGLYMA11G14940.26e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-54WUSCHEL related homeobox 2